(data stored in ACNUC1104 zone)

EMBL: CP000717.PE610

CP000717.PE610       Location/Qualifiers
FT   CDS             complement(700382..700795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10610"
FT                   /old_locus_tag="TBFG_00601"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0598c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10610"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04953"
FT                   /protein_id="ABR04953.1"
FT                   /translation="MKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAET
FT                   YSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSRTTEHLPRVLAQFEITGGAVYDALV
FT                   ALAAAEHRAELATRDARAKDTYEKIGVHVVVAA"
     MKPPLAVDTS VAIPLLVRTH TAHAAVVAWW AHREAALCGH ALAETYSVLT RLPRDLRLAP        60
     MDAARLLTER FAAPLLLSSR TTEHLPRVLA QFEITGGAVY DALVALAAAE HRAELATRDA       120
     RAKDTYEKIG VHVVVAA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page