(data stored in ACNUC1104 zone)

EMBL: CP000717.PE612

CP000717.PE612       Location/Qualifiers
FT   CDS             complement(701132..702265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10612"
FT                   /old_locus_tag="TBFG_00603"
FT                   /old_locus_tag="TBFG_00604"
FT                   /product="two component sensor kinase"
FT                   /note="Mapped to H37Rv Rv0599c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10612"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04955"
FT                   /protein_id="ABR04955.1"
FT                   /translation="MAHPMATHPRLQRRHGARSGSSRCRHRRPVPRRRSRSRPRWRAAR
FT                   AHRRHHRRSGPGIGDHPADRARHRRGGRLPAQPRRAAARRPDPRGGANTDHHAAPRHRR
FT                   AAAGTSHRRRDRLASNDSQHHAHPTATGPRPRTTVRRRRQPRITHPVGTADHRTRTALR
FT                   RPRPADQLSAALRSALEETRRLSGLADQLLTLARADRPESHPSAKAVPITPLLHESVAR
FT                   FAATGADITTRAEPDLFVSIDPDHLRRILTAVLDNAITHGDGEIAVTAHARDGAVDIGV
FT                   RDHGPGFADHFLPVAFDRFTRADTARGGRGSGLGLAIVAALTTTHGGHANATNHPDGGA
FT                   ELRITLPTPRPPFHEELPRITSSDTKDPNREHDTSDQ"
     MAHPMATHPR LQRRHGARSG SSRCRHRRPV PRRRSRSRPR WRAARAHRRH HRRSGPGIGD        60
     HPADRARHRR GGRLPAQPRR AAARRPDPRG GANTDHHAAP RHRRAAAGTS HRRRDRLASN       120
     DSQHHAHPTA TGPRPRTTVR RRRQPRITHP VGTADHRTRT ALRRPRPADQ LSAALRSALE       180
     ETRRLSGLAD QLLTLARADR PESHPSAKAV PITPLLHESV ARFAATGADI TTRAEPDLFV       240
     SIDPDHLRRI LTAVLDNAIT HGDGEIAVTA HARDGAVDIG VRDHGPGFAD HFLPVAFDRF       300
     TRADTARGGR GSGLGLAIVA ALTTTHGGHA NATNHPDGGA ELRITLPTPR PPFHEELPRI       360
     TSSDTKDPNR EHDTSDQ                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page