(data stored in ACNUC1104 zone)

EMBL: CP000717.PE613

CP000717.PE613       Location/Qualifiers
FT   CDS             complement(702266..703027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10613"
FT                   /old_locus_tag="TBFG_00605"
FT                   /product="two component system DNA binding transcriptional
FT                   regulatory protein tcrA"
FT                   /note="Mapped to H37Rv Rv0602c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10613"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04956"
FT                   /protein_id="ABR04956.1"
FT                   /translation="MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEE
FT                   GHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARG
FT                   AVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRV
FT                   WRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDK
FT                   IDRPFGVTSLETIRGAGYRLRKDGGRHALPR"
     MADETTMRAG RGPGRACGRV SGVRILVVED EPKMTALLAR ALTEEGHTVD TVADGRHAVA        60
     AVDGGDYDAV VLDVMLPGID GFEVCARLRR QRVWTPVLML TARGAVTDRI AGLDGGADDY       120
     LTKPFNLDEL FARLRALSRR GPIPRPPTLE AGDLRLDPSE HRVWRADTEI RLSHKEFTLL       180
     EALIRRPGIV HTRAQLLERC WDAAYEARSN IVDVYIRYLR DKIDRPFGVT SLETIRGAGY       240
     RLRKDGGRHA LPR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page