(data stored in ACNUC1104 zone)

EMBL: CP000717.PE621

CP000717.PE621       Location/Qualifiers
FT   CDS             complement(707980..709137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10621"
FT                   /old_locus_tag="TBFG_00613"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0610c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10621"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04964"
FT                   /protein_id="ABR04964.1"
FT                   /translation="MDDELRGLLARYARGELSADDARRAILRYPKWRVAEIDGELETVA
FT                   LDDGTPMLIAESSASDGREYSGLELVRDIAPLVGGLSFDPDEPWGSAFRPGALPELQNW
FT                   ARTVELEDAVAKPGPGQRDLLYEGPWWVAVSPGTGRPAVHRADGLDVITIMTAPDAAAT
FT                   FRRTERHRGLDVVRLGPALWGDLAKRSDFDGVRLNPLRPLAQLWPPHVPAMLVAGCDPR
FT                   PNAEPLPARTVAEIHLWLDQHGARQEKRELSNRATPVGEVTVARAWWNYDRREIAFTRV
FT                   APASDTEGLGSVPSRILCAGKLRQSIQSKLAGLPRLTWRADAWHRQRAALAVGWALELE
FT                   KLVCGERVPFAALRTPEGAHLWHLEPQAFTARAIRKLRDRAASFR"
     MDDELRGLLA RYARGELSAD DARRAILRYP KWRVAEIDGE LETVALDDGT PMLIAESSAS        60
     DGREYSGLEL VRDIAPLVGG LSFDPDEPWG SAFRPGALPE LQNWARTVEL EDAVAKPGPG       120
     QRDLLYEGPW WVAVSPGTGR PAVHRADGLD VITIMTAPDA AATFRRTERH RGLDVVRLGP       180
     ALWGDLAKRS DFDGVRLNPL RPLAQLWPPH VPAMLVAGCD PRPNAEPLPA RTVAEIHLWL       240
     DQHGARQEKR ELSNRATPVG EVTVARAWWN YDRREIAFTR VAPASDTEGL GSVPSRILCA       300
     GKLRQSIQSK LAGLPRLTWR ADAWHRQRAA LAVGWALELE KLVCGERVPF AALRTPEGAH       360
     LWHLEPQAFT ARAIRKLRDR AASFR                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page