(data stored in ACNUC1104 zone)

EMBL: CP000717.PE623

CP000717.PE623       Location/Qualifiers
FT   CDS             709552..710157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10623"
FT                   /old_locus_tag="TBFG_00615"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0612"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10623"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04965"
FT                   /protein_id="ABR04965.1"
FT                   /translation="MLGPIRQPRLTVRPGRLPGMIAGVAAKRMNREQFFRAASGLDEDR
FT                   LRKALWNLYWRGTANMRERIEAELASAGRARPARKIKPPADPDIVGWEVDEFVSLARSG
FT                   AYLGGDRRVSPRERSRWRFTFKRLAAEAQDALRAEDAEPAASALEQLIDLAREADGYDY
FT                   FRSDDPVAAAGFVVSDVAAAGHPHFREFAAEIGAAIPP"
     MLGPIRQPRL TVRPGRLPGM IAGVAAKRMN REQFFRAASG LDEDRLRKAL WNLYWRGTAN        60
     MRERIEAELA SAGRARPARK IKPPADPDIV GWEVDEFVSL ARSGAYLGGD RRVSPRERSR       120
     WRFTFKRLAA EAQDALRAED AEPAASALEQ LIDLAREADG YDYFRSDDPV AAAGFVVSDV       180
     AAAGHPHFRE FAAEIGAAIP P                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page