(data stored in ACNUC1104 zone)

EMBL: CP000717.PE625

CP000717.PE625       Location/Qualifiers
FT   CDS             712827..713576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10625"
FT                   /old_locus_tag="TBFG_00617"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0614"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10625"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04968"
FT                   /protein_id="ABR04968.1"
FT                   /translation="MTAPTRWTLADGRELLFFSLPGPRTSGTAAERVARHAQAQTFAGD
FT                   IRQRAIQLVVSEQEVASKITAATAGIATTTFPETPSIDDTIIGNDNRDTGVRLVDVKQD
FT                   GGTSPPPPFAPWDTPDGTPPPGTGLSPTLQQMILGGDPANLTGQGLADNVQRFVQSLPA
FT                   NDPNTAWLRGQVADLQAHVADIEYARTHCSTNDWIDRTAQFASGAIVFSIGVLTAETGA
FT                   GVVAAAAGGVGAATAGVSLLQCLVGSK"
     MTAPTRWTLA DGRELLFFSL PGPRTSGTAA ERVARHAQAQ TFAGDIRQRA IQLVVSEQEV        60
     ASKITAATAG IATTTFPETP SIDDTIIGND NRDTGVRLVD VKQDGGTSPP PPFAPWDTPD       120
     GTPPPGTGLS PTLQQMILGG DPANLTGQGL ADNVQRFVQS LPANDPNTAW LRGQVADLQA       180
     HVADIEYART HCSTNDWIDR TAQFASGAIV FSIGVLTAET GAGVVAAAAG GVGAATAGVS       240
     LLQCLVGSK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page