(data stored in ACNUC1104 zone)

EMBL: CP000717.PE63

CP000717.PE63        Location/Qualifiers
FT   CDS             68724..69764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10063"
FT                   /old_locus_tag="TBFG_00064"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0064"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04406"
FT                   /protein_id="ABR04406.1"
FT                   /translation="METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLW
FT                   FGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPDEPQRDPVAPL
FT                   RSAVMRRPRLFGWGIAVTLGVVCGLIASFDWLKVQLFVHGGTFGIVDPEFGYDIGFFVF
FT                   DLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRGMLTQAARVQLAVFAGAVVL
FT                   LKAVAYWLDRYELLSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLR
FT                   DLRIPAMAGRTAGAVGDPGRWTVAAADGAVLGASQRRRCRTPIYPTQHRSDPRGVSDRW
FT                   RLGPVP"
     METGSPGKRP VLPKRARLLV TAGMGMLALL LFGPRLVDIY VDWLWFGEVG FRSVWITVLL        60
     TRLAIVAAVA LVVAGIVLAA LLLAYRSRPF FVPDEPQRDP VAPLRSAVMR RPRLFGWGIA       120
     VTLGVVCGLI ASFDWLKVQL FVHGGTFGIV DPEFGYDIGF FVFDLPFYRS VLNWLFVAVV       180
     LAFLASLLTH YLFGGLRLTT GRGMLTQAAR VQLAVFAGAV VLLKAVAYWL DRYELLSSGR       240
     KEPTFTGAGY TDIHAELPAK LVLVAIAVLC AVSFFTAIFL RDLRIPAMAG RTAGAVGDPG       300
     RWTVAAADGA VLGASQRRRC RTPIYPTQHR SDPRGVSDRW RLGPVP                      346
//

If you have problems or comments...

PBIL Back to PBIL home page