(data stored in ACNUC1104 zone)

EMBL: CP000717.PE632

CP000717.PE632       Location/Qualifiers
FT   CDS             717421..718494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10632"
FT                   /old_locus_tag="TBFG_00624"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0621"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10632"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04975"
FT                   /protein_id="ABR04975.1"
FT                   /translation="MQPMAGDRGADPGPANVTPGADDHAQHASPTVLCPQGHVNAWDYR
FT                   FCERCGSPIGVVPWPSEESGTRQTAPARSFVPLVVLAATLLVVAVVVTAVGYAVTRPAR
FT                   NDREEPSSARGAATTGVPFAQAEAASCPDDPVLEAESIDLTSDGLAVSAAFMSACAGGD
FT                   VESNSALEVTVADGRRDVAAGSFDFSADPLRIEPGVPARRTLVFPPGMYWRTPDMLSGA
FT                   PALAATRKGRSDRSAARGGSARTTMVAAASAAPAYGSINAVAGAVLVELRDSDFPYVRV
FT                   GIANRWVPQVSSKRVGLVAAGKTWTSADILRDHLALRQRFGGARLVWSGHWTTFSGPDF
FT                   WVTVVGPAQPTAAEANR"
     MQPMAGDRGA DPGPANVTPG ADDHAQHASP TVLCPQGHVN AWDYRFCERC GSPIGVVPWP        60
     SEESGTRQTA PARSFVPLVV LAATLLVVAV VVTAVGYAVT RPARNDREEP SSARGAATTG       120
     VPFAQAEAAS CPDDPVLEAE SIDLTSDGLA VSAAFMSACA GGDVESNSAL EVTVADGRRD       180
     VAAGSFDFSA DPLRIEPGVP ARRTLVFPPG MYWRTPDMLS GAPALAATRK GRSDRSAARG       240
     GSARTTMVAA ASAAPAYGSI NAVAGAVLVE LRDSDFPYVR VGIANRWVPQ VSSKRVGLVA       300
     AGKTWTSADI LRDHLALRQR FGGARLVWSG HWTTFSGPDF WVTVVGPAQP TAAEANR          357
//

If you have problems or comments...

PBIL Back to PBIL home page