(data stored in ACNUC1104 zone)

EMBL: CP000717.PE633

CP000717.PE633       Location/Qualifiers
FT   CDS             718598..719545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10633"
FT                   /old_locus_tag="TBFG_00625"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0622"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10633"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04976"
FT                   /protein_id="ABR04976.1"
FT                   /translation="MSFCVYCGAELADPTRCGACGAYKIGSTWHRTTTPTVGAATTATG
FT                   WRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDPLGQQQLDQSGAVGVSPSAVSGWVRSG
FT                   HRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDDKYLAALRRSGLTGEFNSDANAI
FT                   ARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQFSDGFHILETITVTGSFTLKDESPNVY
FT                   APAITVSGSGCSGSAGYADIDRGTQVTVKNGQGDILATAFLQAGQGGRFLCTFPFSFEI
FT                   TEGEDRYVVSVSRRGEMSYSFADLKANGLSLVLG"
     MSFCVYCGAE LADPTRCGAC GAYKIGSTWH RTTTPTVGAA TTATGWRPDP TGRHEGRYFV        60
     AGQPTDLVRE GDAEAVDPLG QQQLDQSGAV GVSPSAVSGW VRSGHRRLWW ALAGVVAFLG       120
     LVGAGVVGTL FLNRDRESID DKYLAALRRS GLTGEFNSDA NAIARGKQVC RQLQDGGEQQ       180
     GMPVDQVAVQ YYCPQFSDGF HILETITVTG SFTLKDESPN VYAPAITVSG SGCSGSAGYA       240
     DIDRGTQVTV KNGQGDILAT AFLQAGQGGR FLCTFPFSFE ITEGEDRYVV SVSRRGEMSY       300
     SFADLKANGL SLVLG                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page