(data stored in ACNUC1104 zone)

EMBL: CP000717.PE637

CP000717.PE637       Location/Qualifiers
FT   CDS             721253..721513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10637"
FT                   /old_locus_tag="TBFG_00629"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0626"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10637"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04980"
FT                   /protein_id="ABR04980.1"
FT                   /translation="MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRR
FT                   RRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR"
     MSEVASRELR NDTAGVLRRV RAGEDVTITV SGRPVAVLTP VRPRRRRWLS KTEFLSRLRG        60
     AQADPGLRND LAVLAGDTTE DLGPIR                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page