(data stored in ACNUC1104 zone)

EMBL: CP000717.PE639

CP000717.PE639       Location/Qualifiers
FT   CDS             complement(721989..723140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10639"
FT                   /old_locus_tag="TBFG_00631"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0628c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10639"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04982"
FT                   /protein_id="ABR04982.1"
FT                   /translation="MRIGVGVSTAPDVRRAAAEAAAHAREELAGGTPALAVLLGSRSHT
FT                   DQAVDLLAAVQASVEPAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHLDFVR
FT                   TGSGALITGYRFDRTAHDLHLLLPDPYSFPSNLLIEHLNTDLPGTTVVGGVVSGGRRRG
FT                   DTRLFRDRDVLTSGLVGVRLPGAHSVSVVSQGCRPIGEPYIVTGADGAVITELGGRPPL
FT                   HRLREIVLGMAPDEQELVSRGLQIGIVVDEHLAVPGQGDFLIRGLLGADPTTGAIGIGE
FT                   VVEVGATVQFQVRDAAAADKDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHD
FT                   ASTIEDLLGGIPLAGFFAAGEIGPVAGHNALHGFTASMALFVD"
     MRIGVGVSTA PDVRRAAAEA AAHAREELAG GTPALAVLLG SRSHTDQAVD LLAAVQASVE        60
     PAALIGCVAQ GIVAGRHELE NEPAVAVWLA SGPPAETFHL DFVRTGSGAL ITGYRFDRTA       120
     HDLHLLLPDP YSFPSNLLIE HLNTDLPGTT VVGGVVSGGR RRGDTRLFRD RDVLTSGLVG       180
     VRLPGAHSVS VVSQGCRPIG EPYIVTGADG AVITELGGRP PLHRLREIVL GMAPDEQELV       240
     SRGLQIGIVV DEHLAVPGQG DFLIRGLLGA DPTTGAIGIG EVVEVGATVQ FQVRDAAAAD       300
     KDLRLAVERA AAELPGPPVG GLLFTCNGRG RRMFGVTDHD ASTIEDLLGG IPLAGFFAAG       360
     EIGPVAGHNA LHGFTASMAL FVD                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page