(data stored in ACNUC1104 zone)

EMBL: CP000717.PE641

CP000717.PE641       Location/Qualifiers
FT   CDS             complement(724957..728241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10641"
FT                   /old_locus_tag="TBFG_00633"
FT                   /product="exonuclease V beta subunit recB"
FT                   /note="Mapped to H37Rv Rv0630c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10641"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04984"
FT                   /protein_id="ABR04984.1"
FT                   /translation="MDRFELLGPLPREGTTTVLEASAGTGKTFALAGLVTRYLAETAAT
FT                   LDEMLLITFNRAASRELRERVRGQIVEAVGALQGDAPPSGELVEHLLRGSDAERAQKRS
FT                   RLRDALANFDAATIATTHEFCGSVLKSLGVAGDNAADVELKESLTDLVTEIVDDRYLAN
FT                   FGRQETDPELTYAEALALALAVVDDPCAQLRPPDPEPGSKAAVRLRFAAEVLEELERRK
FT                   GRLRAQGFNDLLIRLATALEAADSPARDRMRERWRIVLVDEFQDTDPMQWRVLERAFSR
FT                   HSALILIGDPKQAIYGFRGGDIHTYLKAAGTADARYTLGVNWRSDRALVESLQTVLRDA
FT                   TLGHADIVVRGTDAHHAGHRLASAPRPAPFRLRVVKRHTLGYDGTAHVPIEALRRHIPD
FT                   DLAADVAALLASGATFAGRPVVAADIAVIVEHHKDARACRNALAEAGIPAIYTGDTDVF
FT                   ASQAAKDWLCLLEAFDAPQRSGLVRAAACTMFFGETAESLAAEGDALTDRVAGTLREWA
FT                   DHARHRGVAAVFQAAQLAGMGRRVLSQRGGERDLTDLAHIAQLLHEAAHRERLGLPGLR
FT                   DWLRRQAKAGAGPPEHNRRLDSDAAAVQIMTVFVAKGLQFPIVYLPFAFNRNVRSDDIL
FT                   LYHDDGTRCLYIGGKDGGAQRRTVEGLNRVEAAHDNLRLTYVALTRAQSQVVAWWAPTF
FT                   DEVNGGLSRLLRGRRPGQSQVPDRCTPRVTDEQAWAVFAQWEAAGGPSVEESVIGARSS
FT                   LEKPVPVPGFEVRHFHRRIDTTWRRTSYSDLVRGSEAVTVTSEPAAGGRADEVEIAVVA
FT                   APGSGADLTSPLAALPSGASFGSLVHAVLETADPAAPDLAAELEAQVRRHAPWWTVDVD
FT                   HAQLAPELARALLPMHDTPLGPAAAALTLRQIGVRDRLRELDFEMPLAGGDLRGRSPDV
FT                   SLADVGELLASHLPGDDPLSPYADRLGSAGLGDQPLRGYLAGSIDVVLRLPGQRYLVVD
FT                   YKTNHLGDTAADYGFERLTEAMLHSDYPLQALLYVVVLHRFLRWRQRDYAPARHLGGVL
FT                   YLFVRGMCGAATPVTAGHPAGVFTWNPPTALVVALSDLLDRGRLQS"
     MDRFELLGPL PREGTTTVLE ASAGTGKTFA LAGLVTRYLA ETAATLDEML LITFNRAASR        60
     ELRERVRGQI VEAVGALQGD APPSGELVEH LLRGSDAERA QKRSRLRDAL ANFDAATIAT       120
     THEFCGSVLK SLGVAGDNAA DVELKESLTD LVTEIVDDRY LANFGRQETD PELTYAEALA       180
     LALAVVDDPC AQLRPPDPEP GSKAAVRLRF AAEVLEELER RKGRLRAQGF NDLLIRLATA       240
     LEAADSPARD RMRERWRIVL VDEFQDTDPM QWRVLERAFS RHSALILIGD PKQAIYGFRG       300
     GDIHTYLKAA GTADARYTLG VNWRSDRALV ESLQTVLRDA TLGHADIVVR GTDAHHAGHR       360
     LASAPRPAPF RLRVVKRHTL GYDGTAHVPI EALRRHIPDD LAADVAALLA SGATFAGRPV       420
     VAADIAVIVE HHKDARACRN ALAEAGIPAI YTGDTDVFAS QAAKDWLCLL EAFDAPQRSG       480
     LVRAAACTMF FGETAESLAA EGDALTDRVA GTLREWADHA RHRGVAAVFQ AAQLAGMGRR       540
     VLSQRGGERD LTDLAHIAQL LHEAAHRERL GLPGLRDWLR RQAKAGAGPP EHNRRLDSDA       600
     AAVQIMTVFV AKGLQFPIVY LPFAFNRNVR SDDILLYHDD GTRCLYIGGK DGGAQRRTVE       660
     GLNRVEAAHD NLRLTYVALT RAQSQVVAWW APTFDEVNGG LSRLLRGRRP GQSQVPDRCT       720
     PRVTDEQAWA VFAQWEAAGG PSVEESVIGA RSSLEKPVPV PGFEVRHFHR RIDTTWRRTS       780
     YSDLVRGSEA VTVTSEPAAG GRADEVEIAV VAAPGSGADL TSPLAALPSG ASFGSLVHAV       840
     LETADPAAPD LAAELEAQVR RHAPWWTVDV DHAQLAPELA RALLPMHDTP LGPAAAALTL       900
     RQIGVRDRLR ELDFEMPLAG GDLRGRSPDV SLADVGELLA SHLPGDDPLS PYADRLGSAG       960
     LGDQPLRGYL AGSIDVVLRL PGQRYLVVDY KTNHLGDTAA DYGFERLTEA MLHSDYPLQA      1020
     LLYVVVLHRF LRWRQRDYAP ARHLGGVLYL FVRGMCGAAT PVTAGHPAGV FTWNPPTALV      1080
     VALSDLLDRG RLQS                                                        1094
//

If you have problems or comments...

PBIL Back to PBIL home page