(data stored in ACNUC1104 zone)

EMBL: CP000717.PE644

CP000717.PE644       Location/Qualifiers
FT   CDS             complement(732555..733394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10644"
FT                   /old_locus_tag="TBFG_00636"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0633c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10644"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04987"
FT                   /protein_id="ABR04987.1"
FT                   /translation="MVDSMGWVLSSWHEVTGVDSGTWLAWAAWAALGLGVVALVVTKRQ
FT                   IQRNRRLAAEQTRPYVAMFMEPHVADWHVIELVVRNFGRTAAYDVRFSFPNPPTVAQYE
FT                   NAANGYADVVELRLPQELPMLAPGQEWRMVWDSALDRAEIGRGIESRFPGTVTYYDRPE
FT                   QPRRWRFWRRGRRPLETKVVLDWDALPPVARIELMTTHDLAKREKQKLELLRSLLTYFH
FT                   YASKETRPDVFRSEIDRINRAAAETQDRWRARQVEVPTEVSQRSEGQGPQPTRIPAG"
     MVDSMGWVLS SWHEVTGVDS GTWLAWAAWA ALGLGVVALV VTKRQIQRNR RLAAEQTRPY        60
     VAMFMEPHVA DWHVIELVVR NFGRTAAYDV RFSFPNPPTV AQYENAANGY ADVVELRLPQ       120
     ELPMLAPGQE WRMVWDSALD RAEIGRGIES RFPGTVTYYD RPEQPRRWRF WRRGRRPLET       180
     KVVLDWDALP PVARIELMTT HDLAKREKQK LELLRSLLTY FHYASKETRP DVFRSEIDRI       240
     NRAAAETQDR WRARQVEVPT EVSQRSEGQG PQPTRIPAG                              279
//

If you have problems or comments...

PBIL Back to PBIL home page