(data stored in ACNUC1104 zone)

EMBL: CP000717.PE648

CP000717.PE648       Location/Qualifiers
FT   CDS             735158..735634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10648"
FT                   /old_locus_tag="TBFG_00640"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0635"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10648"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04991"
FT                   /protein_id="ABR04991.1"
FT                   /translation="MALSADIVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEDGA
FT                   AELGYKGLLAPLTFICVFGYKAQAAFFKHANIATAEAQIVQVDQVLKFEKPIVAGDKLY
FT                   CDVYVDSVREAHGTQIIVTKNIVTNEEGDLVQETYTTLAGRAGEDGEGFSDGAA"
     MALSADIVGM HYRYPDHYEV EREKIREYAV AVQNDDAWYF EEDGAAELGY KGLLAPLTFI        60
     CVFGYKAQAA FFKHANIATA EAQIVQVDQV LKFEKPIVAG DKLYCDVYVD SVREAHGTQI       120
     IVTKNIVTNE EGDLVQETYT TLAGRAGEDG EGFSDGAA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page