(data stored in ACNUC1104 zone)

EMBL: CP000717.PE665

CP000717.PE665       Location/Qualifiers
FT   CDS             752610..753002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10665"
FT                   /old_locus_tag="TBFG_00657"
FT                   /product="50S ribosomal protein l7/l12 rplL"
FT                   /note="Mapped to H37Rv Rv0652"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10665"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05008"
FT                   /protein_id="ABR05008.1"
FT                   /translation="MAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAA
FT                   GAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPL
FT                   LEKVAKEAADEAKAKLEAAGATVTVK"
     MAKLSTDELL DAFKEMTLLE LSDFVKKFEE TFEVTAAAPV AVAAAGAAPA GAAVEAAEEQ        60
     SEFDVILEAA GDKKIGVIKV VREIVSGLGL KEAKDLVDGA PKPLLEKVAK EAADEAKAKL       120
     EAAGATVTVK                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page