(data stored in ACNUC1104 zone)

EMBL: CP000717.PE666

CP000717.PE666       Location/Qualifiers
FT   CDS             complement(752995..753690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10666"
FT                   /old_locus_tag="TBFG_00658"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0653c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10666"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05009"
FT                   /protein_id="ABR05009.1"
FT                   /translation="MTSQTGVRDELLHAGVRLLDDHGPDALQTRKVAAAAGTSTMAVYT
FT                   HFGGMRGLIAAIAEEGLRQFDVALTVPQTADPVADLLAIGTAYRRYAIERPHMYRLMFG
FT                   STSAHGINVPARDVLTLKVAEIEHQHPSFAHVVRAVHRCLLAGRFATALGADDDTAIVA
FT                   TAAQFWSQIHGFVMLELAGFYGDRGAAVEPVLAAMTVNLLVALGDSPERAQCSLRAEQT
FT                   QKNTLGRAT"
     MTSQTGVRDE LLHAGVRLLD DHGPDALQTR KVAAAAGTST MAVYTHFGGM RGLIAAIAEE        60
     GLRQFDVALT VPQTADPVAD LLAIGTAYRR YAIERPHMYR LMFGSTSAHG INVPARDVLT       120
     LKVAEIEHQH PSFAHVVRAV HRCLLAGRFA TALGADDDTA IVATAAQFWS QIHGFVMLEL       180
     AGFYGDRGAA VEPVLAAMTV NLLVALGDSP ERAQCSLRAE QTQKNTLGRA T                231
//

If you have problems or comments...

PBIL Back to PBIL home page