(data stored in ACNUC1104 zone)

EMBL: CP000717.PE668

CP000717.PE668       Location/Qualifiers
FT   CDS             755278..756357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10668"
FT                   /old_locus_tag="TBFG_00660"
FT                   /product="ribonucleotide transport ATP-binding protein ABC
FT                   transporter mkl"
FT                   /note="Mapped to H37Rv Rv0655"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10668"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05011"
FT                   /protein_id="ABR05011.1"
FT                   /translation="MRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWED
FT                   VTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELYEIRT
FT                   LFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLALVGLGGDEKKFPGE
FT                   ISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTH
FT                   NINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEGKDEAT
FT                   MAEEQALLDAGHHAGGVEEIEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQA
FT                   AILDDLEGTHKYAVHEIGQ"
     MRYSDSYHTT GRWQPRASTE GFPMGVSIEV NGLTKSFGSS RIWEDVTLTI PAGEVSVLLG        60
     PSGTGKSVFL KSLIGLLRPE RGSIIIDGTD IIECSAKELY EIRTLFGVLF QDGALFGSMN       120
     LYDNTAFPLR EHTKKKESEI RDIVMEKLAL VGLGGDEKKF PGEISGGMRK RAGLARALVL       180
     DPQIILCDEP DSGLDPVRTA YLSQLIMDIN AQIDATILIV THNINIARTV PDNMGMLFRK       240
     HLVMFGPREV LLTSDEPVVR QFLNGRRIGP IGMSEGKDEA TMAEEQALLD AGHHAGGVEE       300
     IEGVPPQISA TPGMPERKAV ARRQARVREM LHTLPKKAQA AILDDLEGTH KYAVHEIGQ        359
//

If you have problems or comments...

PBIL Back to PBIL home page