(data stored in ACNUC1104 zone)

EMBL: CP000717.PE671

CP000717.PE671       Location/Qualifiers
FT   CDS             complement(757454..758170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10671"
FT                   /old_locus_tag="TBFG_00662"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0658c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10671"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05014"
FT                   /protein_id="ABR05014.1"
FT                   /translation="MEAGRADTVAPSHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVS
FT                   AGVLALALAAPTVVAAGLAILITRLRGNGPRTDLRLRWSWRGLRLGLMFGFGGMLVTIP
FT                   ASLVYTAIVGPEANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCEEIIYRGLLWGAVD
FT                   RRWGRWAALVVTTVVFALAHLEFARAPLLVVVAIPIALARFYSGGLLASIVTHQVTNLL
FT                   PGIVLLLGLTGAISLP"
     MEAGRADTVA PSHRWGLGAF LVVELVFLVA STSLAVVLTG HGPVSAGVLA LALAAPTVVA        60
     AGLAILITRL RGNGPRTDLR LRWSWRGLRL GLMFGFGGML VTIPASLVYT AIVGPEANSA       120
     VVRIFGGVRA SWPWALVVFL VVVFVAPLCE EIIYRGLLWG AVDRRWGRWA ALVVTTVVFA       180
     LAHLEFARAP LLVVVAIPIA LARFYSGGLL ASIVTHQVTN LLPGIVLLLG LTGAISLP         238
//

If you have problems or comments...

PBIL Back to PBIL home page