(data stored in ACNUC1104 zone)

EMBL: CP000717.PE672

CP000717.PE672       Location/Qualifiers
FT   CDS             complement(758446..758754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10672"
FT                   /old_locus_tag="TBFG_00663"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0659c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10672"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05015"
FT                   /protein_id="ABR05015.1"
FT                   /translation="MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGL
FT                   VSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRRITRLSPARLHEACQTLRASTGC"
     MRRGELWFAA TPGGDRPVLV LTRDPVADRI GAVVVVALTR TRRGLVSELE LTAVENRVPS        60
     DCVVNFDNIH TLPRTAFRRR ITRLSPARLH EACQTLRAST GC                          102
//

If you have problems or comments...

PBIL Back to PBIL home page