(data stored in ACNUC1104 zone)

EMBL: CP000717.PE679

CP000717.PE679       Location/Qualifiers
FT   CDS             762897..763070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10679"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0666"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10679"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05022"
FT                   /protein_id="ABR05022.1"
FT                   /translation="MTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSS
FT                   LVRARSCRCTAD"
     MTPRTDEGAA APCLMPDVTM PVKRGDARGA LGVGPALFVV SVSSSLVRAR SCRCTAD           57
//

If you have problems or comments...

PBIL Back to PBIL home page