(data stored in ACNUC1104 zone)

EMBL: CP000717.PE691

CP000717.PE691       Location/Qualifiers
FT   CDS             complement(782238..782666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10691"
FT                   /old_locus_tag="TBFG_00679"
FT                   /product="membrane protein mmpS5"
FT                   /note="Mapped to H37Rv Rv0677c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10691"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05034"
FT                   /protein_id="ABR05034.1"
FT                   /translation="MIGTLKRAWIPLLILVVVAIAGFTVQRIRTFFGSEGILVTPKVFA
FT                   DDPEPFDPKVVEYEVSGSGSYVNINYLDLDAKPQRIDGAALPWSLTLKTTAPSAAPNIL
FT                   AQGDGTSITCRITVDGEVKDERTATGVDALTYCFVKSA"
     MIGTLKRAWI PLLILVVVAI AGFTVQRIRT FFGSEGILVT PKVFADDPEP FDPKVVEYEV        60
     SGSGSYVNIN YLDLDAKPQR IDGAALPWSL TLKTTAPSAA PNILAQGDGT SITCRITVDG       120
     EVKDERTATG VDALTYCFVK SA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page