(data stored in ACNUC1104 zone)

EMBL: CP000717.PE694

CP000717.PE694       Location/Qualifiers
FT   CDS             complement(783803..784177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10694"
FT                   /old_locus_tag="TBFG_00682"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0680c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10694"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05037"
FT                   /protein_id="ABR05037.1"
FT                   /translation="MKWNTVAASLAAGVITIAVALAAPPPAAHAKNGDTHVTGQGIERT
FT                   LDCNESTLLVNGTQNIVTALGTCWAVTVMGSSNTVVADTIINDITVYGWDETVFFRNGD
FT                   PFIWDRGRELGMVNRLQRVG"
     MKWNTVAASL AAGVITIAVA LAAPPPAAHA KNGDTHVTGQ GIERTLDCNE STLLVNGTQN        60
     IVTALGTCWA VTVMGSSNTV VADTIINDIT VYGWDETVFF RNGDPFIWDR GRELGMVNRL       120
     QRVG                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page