(data stored in ACNUC1104 zone)

EMBL: CP000717.PE695

CP000717.PE695       Location/Qualifiers
FT   CDS             784416..785072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10695"
FT                   /old_locus_tag="TBFG_00683"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0681"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10695"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05038"
FT                   /protein_id="ABR05038.1"
FT                   /translation="MAAQPQAPSAGGRPRAGKAVKSVARPAKLSRESIVEGALTFLDRE
FT                   GWDSLTINALATQLGTKGPSLYNHVDSLEDLRRAVRIRVIDDIITMLNRVGAGRARDDA
FT                   VLVMAGAYRSYAHHHPGRYSAFTRMPLGGDDPEYTAATRGAAAPVIAVLSSYGLDGEQA
FT                   FYAALEFWSALHGFVLLEMTGVMDDIDTDAVFTDMVLRLAAGMERRTTHGGTAST"
     MAAQPQAPSA GGRPRAGKAV KSVARPAKLS RESIVEGALT FLDREGWDSL TINALATQLG        60
     TKGPSLYNHV DSLEDLRRAV RIRVIDDIIT MLNRVGAGRA RDDAVLVMAG AYRSYAHHHP       120
     GRYSAFTRMP LGGDDPEYTA ATRGAAAPVI AVLSSYGLDG EQAFYAALEF WSALHGFVLL       180
     EMTGVMDDID TDAVFTDMVL RLAAGMERRT THGGTAST                               218
//

If you have problems or comments...

PBIL Back to PBIL home page