(data stored in ACNUC1104 zone)

EMBL: CP000717.PE696

CP000717.PE696       Location/Qualifiers
FT   CDS             785321..785695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10696"
FT                   /old_locus_tag="TBFG_00684"
FT                   /product="30S ribosomal protein S12 rpsL"
FT                   /note="Mapped to H37Rv Rv0682"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10696"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05039"
FT                   /protein_id="ABR05039.1"
FT                   /translation="MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDT
FT                   QGVKNRKQARSRYGAKKEKG"
     MPTIQQLVRK GRRDKISKVK TAALKGSPQR RGVCTRVYTT TPKKPNSALR KVARVKLTSQ        60
     VEVTAYIPGE GHNLQEHSMV LVRGGRVKDL PGVRYKIIRG SLDTQGVKNR KQARSRYGAK       120
     KEKG                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page