(data stored in ACNUC1104 zone)

EMBL: CP000717.PE697

CP000717.PE697       Location/Qualifiers
FT   CDS             785695..786165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10697"
FT                   /old_locus_tag="TBFG_00685"
FT                   /product="30S ribosomal protein S7 rpsG"
FT                   /note="Mapped to H37Rv Rv0683"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10697"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05040"
FT                   /protein_id="ABR05040.1"
FT                   /translation="MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYG
FT                   ALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWL
FT                   VGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW"
     MPRKGPAPKR PLVNDPVYGS QLVTQLVNKV LLKGKKSLAE RIVYGALEQA RDKTGTDPVI        60
     TLKRALDNVK PALEVRSRRV GGATYQVPVE VRPDRSTTLA LRWLVGYSRQ RREKTMIERL       120
     ANEILDASNG LGASVKRRED THKMAEANRA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page