(data stored in ACNUC1104 zone)

EMBL: CP000717.PE713

CP000717.PE713       Location/Qualifiers
FT   CDS             complement(802921..803568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10713"
FT                   /old_locus_tag="TBFG_00701"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0698"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10713"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05056"
FT                   /protein_id="ABR05056.1"
FT                   /translation="MALAKLAQSADRIAARQRMQRSLAQLVATCELPAPTGTAPIERRI
FT                   SESFAASRSTRRSPIAQSMTRPSPPRPGSPTLPVDGEDPFAEAVLTASVSCRLYPTDTG
FT                   GTPADRCTPATGGEFPTSALIASRGAAYPATQPNGPSIRTILRALAIHRRPSANSKLGA
FT                   VTTEFDTSAPRILDQLHASDVIRLDASARCILSPQHRIRIVFRSPMVPRFSG"
     MALAKLAQSA DRIAARQRMQ RSLAQLVATC ELPAPTGTAP IERRISESFA ASRSTRRSPI        60
     AQSMTRPSPP RPGSPTLPVD GEDPFAEAVL TASVSCRLYP TDTGGTPADR CTPATGGEFP       120
     TSALIASRGA AYPATQPNGP SIRTILRALA IHRRPSANSK LGAVTTEFDT SAPRILDQLH       180
     ASDVIRLDAS ARCILSPQHR IRIVFRSPMV PRFSG                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page