(data stored in ACNUC1104 zone)

EMBL: CP000717.PE717

CP000717.PE717       Location/Qualifiers
FT   CDS             805894..806196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10717"
FT                   /old_locus_tag="TBFG_00705"
FT                   /product="50S ribosomal protein L23 rplW"
FT                   /note="Mapped to H37Rv Rv0703"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10717"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05060"
FT                   /protein_id="ABR05060.1"
FT                   /translation="MATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIA
FT                   VEKIFAVKVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA"
     MATLADPRDI ILAPVISEKS YGLLDDNVYT FLVRPDSNKT QIKIAVEKIF AVKVASVNTA        60
     NRQGKRKRTR TGYGKRKSTK RAIVTLAPGS RPIDLFGAPA                             100
//

If you have problems or comments...

PBIL Back to PBIL home page