(data stored in ACNUC1104 zone)

EMBL: CP000717.PE722

CP000717.PE722       Location/Qualifiers
FT   CDS             808979..809395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10722"
FT                   /old_locus_tag="TBFG_00710"
FT                   /product="50S ribosomal protein L16 rplP"
FT                   /note="Mapped to H37Rv Rv0708"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10722"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05065"
FT                   /protein_id="ABR05065.1"
FT                   /translation="MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNR
FT                   QIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLF
FT                   ELSYPNEGVARAALTRAIHKLPIKARIITREEQF"
     MLIPRKVKHR KQHHPRQRGI ASGGTTVNFG DYGIQALEHA YVTNRQIESA RIAINRHIKR        60
     GGKVWINIFP DRPLTKKPAE TRMGSGKGSP EWWVANVKPG RVLFELSYPN EGVARAALTR       120
     AIHKLPIKAR IITREEQF                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page