(data stored in ACNUC1104 zone)

EMBL: CP000717.PE724

CP000717.PE724       Location/Qualifiers
FT   CDS             809628..810035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10724"
FT                   /old_locus_tag="TBFG_00712"
FT                   /product="30S ribosomal protein S17 rpsQ"
FT                   /note="Mapped to H37Rv Rv0710"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10724"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05067"
FT                   /protein_id="ABR05067.1"
FT                   /translation="MAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPK
FT                   HTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSV
FT                   AGIGDRVSLMETRPLSATKRWRLVEILEKAK"
     MAEAKTGAKA APRVAKAAKA APKKAAPNDA EAIGAANAAN VKGPKHTPRT PKPRGRRKTR        60
     IGYVVSDKMQ KTIVVELEDR MRHPLYGKII RTTKKVKAHD EDSVAGIGDR VSLMETRPLS       120
     ATKRWRLVEI LEKAK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page