(data stored in ACNUC1104 zone)

EMBL: CP000717.PE727

CP000717.PE727       Location/Qualifiers
FT   CDS             813815..814756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10727"
FT                   /old_locus_tag="TBFG_00715"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0713"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10727"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05070"
FT                   /protein_id="ABR05070.1"
FT                   /translation="MAGSDPPTGGPASQAGSDAGASPEHKHMSRRKHLVLDVCIILGVL
FT                   IAYVFSLLGYDWLAHTPGPLPQPDVGTTDDTVVLIRFEELHTVANRLDVKVLVLPDDSM
FT                   IDHRLQVLTTDTSVRLYPENELGDLQYPVGKLPAQVATTIEAHGNPGAWPFDTYTTDTV
FT                   QADVLVGAGDNRQYVPARVEVTGSLEGWDISAVRVGESSQTSDRPDNVIITLKRAKGPL
FT                   VFDLGICLVLITLPTLALFVAIQMITGRRKFQPPFGTWYAAMLFAVVPLRTILPGSPPA
FT                   GAWIDRAVVIWVLIALAAAMVVYIVAWYRESD"
     MAGSDPPTGG PASQAGSDAG ASPEHKHMSR RKHLVLDVCI ILGVLIAYVF SLLGYDWLAH        60
     TPGPLPQPDV GTTDDTVVLI RFEELHTVAN RLDVKVLVLP DDSMIDHRLQ VLTTDTSVRL       120
     YPENELGDLQ YPVGKLPAQV ATTIEAHGNP GAWPFDTYTT DTVQADVLVG AGDNRQYVPA       180
     RVEVTGSLEG WDISAVRVGE SSQTSDRPDN VIITLKRAKG PLVFDLGICL VLITLPTLAL       240
     FVAIQMITGR RKFQPPFGTW YAAMLFAVVP LRTILPGSPP AGAWIDRAVV IWVLIALAAA       300
     MVVYIVAWYR ESD                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page