(data stored in ACNUC1104 zone)

EMBL: CP000717.PE730

CP000717.PE730       Location/Qualifiers
FT   CDS             815928..816491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10730"
FT                   /old_locus_tag="TBFG_00718"
FT                   /product="50S ribosomal protein L5 rplE"
FT                   /note="Mapped to H37Rv Rv0716"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10730"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05073"
FT                   /protein_id="ABR05073.1"
FT                   /translation="MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNM
FT                   GVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMW
FT                   EFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINV
FT                   VTSAATDDEGRALLRALGFPFKEN"
     MTTAQKVQPR LKERYRSEIR DALRKQFGYG NVMQIPTVTK VVVNMGVGEA ARDAKLINGA        60
     VNDLALITGQ KPEVRRARKS IAQFKLREGM PVGVRVTLRG DRMWEFLDRL TSIALPRIRD       120
     FRGLSPKQFD GVGNYTFGLA EQAVFHEVDV DKIDRVRGMD INVVTSAATD DEGRALLRAL       180
     GFPFKEN                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page