(data stored in ACNUC1104 zone)

EMBL: CP000717.PE731

CP000717.PE731       Location/Qualifiers
FT   CDS             816496..816681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10731"
FT                   /old_locus_tag="TBFG_00719"
FT                   /product="30S ribosomal protein S14 rpsN1"
FT                   /note="Mapped to H37Rv Rv0717"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10731"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05074"
FT                   /protein_id="ABR05074.1"
FT                   /translation="MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLR
FT                   EMAHAGELPGVQKSSW"
     MAKKALVNKA AGKPRFAVRA YTRCSKCGRP RAVYRKFGLC RICLREMAHA GELPGVQKSS        60
     W                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page