(data stored in ACNUC1104 zone)

EMBL: CP000717.PE733

CP000717.PE733       Location/Qualifiers
FT   CDS             817267..817806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10733"
FT                   /old_locus_tag="TBFG_00721"
FT                   /product="50S ribosomal protein L6 rplF"
FT                   /note="Mapped to H37Rv Rv0719"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10733"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05076"
FT                   /protein_id="ABR05076.1"
FT                   /translation="MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVAR
FT                   NDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNL
FT                   EFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGV
FT                   RYEGEQIRRKVGKTGK"
     MSRIGKQPIP VPAGVDVTIE GQSISVKGPK GTLGLTVAEP IKVARNDDGA IVVTRPDDER        60
     RNRSLHGLSR TLVSNLVTGV TQGYTTKMEI FGVGYRVQLK GSNLEFALGY SHPVVIEAPE       120
     GITFAVQAPT KFTVSGIDKQ KVGQIAANIR RLRRPDPYKG KGVRYEGEQI RRKVGKTGK        179
//

If you have problems or comments...

PBIL Back to PBIL home page