(data stored in ACNUC1104 zone)

EMBL: CP000717.PE734

CP000717.PE734       Location/Qualifiers
FT   CDS             817809..818177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10734"
FT                   /old_locus_tag="TBFG_00722"
FT                   /product="50S ribosomal protein L18 rplR"
FT                   /note="Mapped to H37Rv Rv0720"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10734"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05077"
FT                   /protein_id="ABR05077.1"
FT                   /translation="MAQSVSATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQ
FT                   LVNDLNGTTVAAASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTY
FT                   GGRIAALADAARENGLSF"
     MAQSVSATRR ISRLRRHTRL RKKLSGTAER PRLVVHRSAR HIHVQLVNDL NGTTVAAASS        60
     IEADVRGVPG DKKARSVRVG QLIAERAKAA GIDTVVFDRG GYTYGGRIAA LADAARENGL       120
     SF                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page