(data stored in ACNUC1104 zone)

EMBL: CP000717.PE736

CP000717.PE736       Location/Qualifiers
FT   CDS             818862..819059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10736"
FT                   /old_locus_tag="TBFG_00724"
FT                   /product="50S ribosomal protein L30 rpmD"
FT                   /note="Mapped to H37Rv Rv0722"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10736"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05079"
FT                   /protein_id="ABR05079.1"
FT                   /translation="MSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNAATRG
FT                   LIAVVRHLVEVEPAQTGGKT"
     MSQLKITQVR STIGARWKQR ESLRTLGLRR IRHSVIREDN AATRGLIAVV RHLVEVEPAQ        60
     TGGKT                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page