(data stored in ACNUC1104 zone)

EMBL: CP000717.PE737

CP000717.PE737       Location/Qualifiers
FT   CDS             819059..819499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10737"
FT                   /old_locus_tag="TBFG_00725"
FT                   /product="50S ribosomal protein L15 rplO"
FT                   /note="Mapped to H37Rv Rv0723"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10737"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05080"
FT                   /protein_id="ABR05080.1"
FT                   /translation="MTLKLHDLRPARGSKIARTRVGRGDGSKGKTAGRGTKGTRARKQV
FT                   PVTFEGGQMPIHMRLPKLKGFRNRFRTEYEIVNVGDINRLFPQGGAVGVDDLVAKGAVR
FT                   KNALVKVLGDGKLTAKVDVSAHKFSGSARAKITAAGGSATEL"
     MTLKLHDLRP ARGSKIARTR VGRGDGSKGK TAGRGTKGTR ARKQVPVTFE GGQMPIHMRL        60
     PKLKGFRNRF RTEYEIVNVG DINRLFPQGG AVGVDDLVAK GAVRKNALVK VLGDGKLTAK       120
     VDVSAHKFSG SARAKITAAG GSATEL                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page