(data stored in ACNUC1104 zone)

EMBL: CP000717.PE74

CP000717.PE74        Location/Qualifiers
FT   CDS             82881..84116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10074"
FT                   /old_locus_tag="TBFG_00074"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0074"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10074"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04417"
FT                   /protein_id="ABR04417.1"
FT                   /translation="MGDLSISQVSARPGRIGIRARQMFDGYRFQRGPVLVVVEDGRISA
FT                   VDFAGSACPDMNLVDLGESTLLPGLVDAHAHLCWDPDGRPEDLAGDPHAVLVGRARRHA
FT                   AAALRSGITTIRDLGDRDYAALALREEYRQKTTVGPELVVSGPPLTRSGGHCWFLGGVA
FT                   DSVEELVDAVQERAARGADWIKVMATGGFVTTASDPWQPQYGSGQLAAVVAAAEQVGLP
FT                   VTAHAHATAGIAAAVAAGVDGIEHCTFLSEGSAAASPDVVEAIVAQGVWCGMTIPRVYP
FT                   EMPENLVAVVQDGWRNIRRLIDAGARVALSTDAGVAPGRRHDVLPDDLVYLSRHGFTST
FT                   EVLTGATAAAAASCGLGHRKGRIAPGYDADLLAVAAGVDHDPAGLCDVKAVWRSGTQVP
FT                   LQASAVGYNTPS"
     MGDLSISQVS ARPGRIGIRA RQMFDGYRFQ RGPVLVVVED GRISAVDFAG SACPDMNLVD        60
     LGESTLLPGL VDAHAHLCWD PDGRPEDLAG DPHAVLVGRA RRHAAAALRS GITTIRDLGD       120
     RDYAALALRE EYRQKTTVGP ELVVSGPPLT RSGGHCWFLG GVADSVEELV DAVQERAARG       180
     ADWIKVMATG GFVTTASDPW QPQYGSGQLA AVVAAAEQVG LPVTAHAHAT AGIAAAVAAG       240
     VDGIEHCTFL SEGSAAASPD VVEAIVAQGV WCGMTIPRVY PEMPENLVAV VQDGWRNIRR       300
     LIDAGARVAL STDAGVAPGR RHDVLPDDLV YLSRHGFTST EVLTGATAAA AASCGLGHRK       360
     GRIAPGYDAD LLAVAAGVDH DPAGLCDVKA VWRSGTQVPL QASAVGYNTP S                411
//

If you have problems or comments...

PBIL Back to PBIL home page