(data stored in ACNUC1104 zone)

EMBL: CP000717.PE746

CP000717.PE746       Location/Qualifiers
FT   CDS             828669..829994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10746"
FT                   /old_locus_tag="TBFG_00734"
FT                   /product="preprotein translocase secY subunit"
FT                   /note="Mapped to H37Rv Rv0732"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10746"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05089"
FT                   /protein_id="ABR05089.1"
FT                   /translation="MLSAFISSLRTVDLRRKILFTLGIVILYRVGAALPSPGVNFPNVQ
FT                   QCIKEASAGEAGQIYSLINLFSGGALLKLTVFAVGVMPYITASIIVQLLTVVIPRFEEL
FT                   RKEGQAGQSKMTQYTRYLAIALAILQATSIVALAANGGLLQGCSLDIIADQSIFTLVVI
FT                   VLVMTGGAALVMWMGELITERGIGNGMSLLIFVGIAARIPAEGQSILESRGGVVFTAVC
FT                   AAALIIIVGVVFVEQGQRRIPVQYAKRMVGRRMYGGTSTYLPLKVNQAGVIPVIFASSL
FT                   IYIPHLITQLIRSGSGVVGNSWWDKFVGTYLSDPSNLVYIGIYFGLIIFFTYFYVSITF
FT                   NPDERADEMKKFGGFIPGIRPGRPTADYLRYVLSRITLPGSIYLGVIAVLPNLFLQIGA
FT                   GGTVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK"
     MLSAFISSLR TVDLRRKILF TLGIVILYRV GAALPSPGVN FPNVQQCIKE ASAGEAGQIY        60
     SLINLFSGGA LLKLTVFAVG VMPYITASII VQLLTVVIPR FEELRKEGQA GQSKMTQYTR       120
     YLAIALAILQ ATSIVALAAN GGLLQGCSLD IIADQSIFTL VVIVLVMTGG AALVMWMGEL       180
     ITERGIGNGM SLLIFVGIAA RIPAEGQSIL ESRGGVVFTA VCAAALIIIV GVVFVEQGQR       240
     RIPVQYAKRM VGRRMYGGTS TYLPLKVNQA GVIPVIFASS LIYIPHLITQ LIRSGSGVVG       300
     NSWWDKFVGT YLSDPSNLVY IGIYFGLIIF FTYFYVSITF NPDERADEMK KFGGFIPGIR       360
     PGRPTADYLR YVLSRITLPG SIYLGVIAVL PNLFLQIGAG GTVQNLPFGG TAVLIMIGVG       420
     LDTVKQIESQ LMQRNYEGFL K                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page