(data stored in ACNUC1104 zone)

EMBL: CP000717.PE747

CP000717.PE747       Location/Qualifiers
FT   CDS             829991..830536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10747"
FT                   /old_locus_tag="TBFG_00735"
FT                   /product="adenylate kinase adk (ATP-AMP
FT                   transphosphorylase)"
FT                   /note="Mapped to H37Rv Rv0733"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10747"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05090"
FT                   /protein_id="ABR05090.1"
FT                   /translation="MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL
FT                   GVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRG
FT                   TDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVD
FT                   AVGTMDEVFARALRALGK"
     MRVLLLGPPG AGKGTQAVKL AEKLGIPQIS TGELFRRNIE EGTKLGVEAK RYLDAGDLVP        60
     SDLTNELVDD RLNNPDAANG FILDGYPRSV EQAKALHEML ERRGTDIDAV LEFRVSEEVL       120
     LERLKGRGRA DDTDDVILNR MKVYRDETAP LLEYYRDQLK TVDAVGTMDE VFARALRALG       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page