(data stored in ACNUC1104 zone)

EMBL: CP000717.PE78

CP000717.PE78        Location/Qualifiers
FT   CDS             86661..87266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10078"
FT                   /old_locus_tag="TBFG_00078"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0078"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04421"
FT                   /protein_id="ABR04421.1"
FT                   /translation="MEIKRRTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAG
FT                   VTRGAMYHQFADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQPVRPLAQVL
FT                   IGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLNG"
     MEIKRRTQEE RSAATREALI TGARKLWGLR GYAEVGTPEI ATEAGVTRGA MYHQFADKAA        60
     LFRDVVEVVE QDVMARMATL VAASGAATPA DAIRAAVDAW LEVSGDPEVR QLILLDAPVV       120
     LGWAGFRDVA QRYSLGMTEQ LITEAIRAGQ LARQPVRPLA QVLIGALDEA AMFIATADDP       180
     KRARRETRQV LRRLIDGMLN G                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page