(data stored in ACNUC1104 zone)

EMBL: CP000717.PE79

CP000717.PE79        Location/Qualifiers
FT   CDS             complement(87341..87934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10079"
FT                   /old_locus_tag="TBFG_00079"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0078A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10079"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04422"
FT                   /protein_id="ABR04422.1"
FT                   /translation="MNAVESTLRRVAKDLTGLRQRWALVGGFAVSARSEPRFTRDVDIV
FT                   VAVANDDAAESLVRQLLTQQYHLLASVEQDAARRLAAVRLGATADTAANVVVDLLFASC
FT                   GIEPEIAEAAEEIEILPDLVAPVATTAHLIAMKLLARDDDRRPQDRSDLRALVDAASPQ
FT                   DIQDARKAIELITLRGFHRDRDLAAEWTRLAAKW"
     MNAVESTLRR VAKDLTGLRQ RWALVGGFAV SARSEPRFTR DVDIVVAVAN DDAAESLVRQ        60
     LLTQQYHLLA SVEQDAARRL AAVRLGATAD TAANVVVDLL FASCGIEPEI AEAAEEIEIL       120
     PDLVAPVATT AHLIAMKLLA RDDDRRPQDR SDLRALVDAA SPQDIQDARK AIELITLRGF       180
     HRDRDLAAEW TRLAAKW                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page