(data stored in ACNUC1104 zone)

EMBL: CP000717.PE80

CP000717.PE80        Location/Qualifiers
FT   CDS             88337..89158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10080"
FT                   /old_locus_tag="TBFG_00080"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0079"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04423"
FT                   /protein_id="ABR04423.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDDLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
     MEPKRSRLVV CAPEPSHARE FPDVAVFSGG RANASQAERL ARAVGRVLAD RGVTGGARVR        60
     LTMANCADGP TLVQINLQVG DTPLRAQAAT AGIDDLRPAL IRLDRQIVRA SAQWCPRPWP       120
     DRPRRRLTTP AEALVTRRKP VVLRRATPLQ AIAAMDAMDY DVHLFTDAET GEDAVVYRAG       180
     PSGLRLARQH HVFPPGWSRC RAPAGPPVPL IVNSRPTPVL TEAAAVDRAR EHGLPFLFFT       240
     DQATGRGQLL YSRYDGNLGL ITPTGDGVAD GLA                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page