(data stored in ACNUC1104 zone)

EMBL: CP000717.PE81

CP000717.PE81        Location/Qualifiers
FT   CDS             89155..89613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10081"
FT                   /old_locus_tag="TBFG_00081"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0080"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04424"
FT                   /protein_id="ABR04424.1"
FT                   /translation="MSPGSRRASPQSAREVVELDRDEAMRLLASVDHGRVVFTRAALPA
FT                   IRPVNHLVVDGRVIGRTRLTAKVSVAVRSSADAGVVVAYEADDLDPRRRTGWSVVVTGL
FT                   ATEVSDPEQVARYQRLLHPWVNMAMDTVVAIEPEIVTGIRIVADSRTP"
     MSPGSRRASP QSAREVVELD RDEAMRLLAS VDHGRVVFTR AALPAIRPVN HLVVDGRVIG        60
     RTRLTAKVSV AVRSSADAGV VVAYEADDLD PRRRTGWSVV VTGLATEVSD PEQVARYQRL       120
     LHPWVNMAMD TVVAIEPEIV TGIRIVADSR TP                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page