(data stored in ACNUC1104 zone)

EMBL: CP000717.PE91

CP000717.PE91        Location/Qualifiers
FT   CDS             98613..99383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10091"
FT                   /old_locus_tag="TBFG_00091"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0090"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10091"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04434"
FT                   /protein_id="ABR04434.1"
FT                   /translation="MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEV
FT                   WRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAV
FT                   WEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYA
FT                   VLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLL
FT                   ISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT"
     MAKNQNRIRN RWELITCGLG GHVTYAPDDA ALAARLRAST GLGEVWRCLR CGDFALGGPQ        60
     GRGAPEDAPL IMRGKALRQA IIIRALGVER LVRALVLALA AWAVWEFRGA RGAIQATLDR       120
     DLPVLRAAGF KVDQMTVIHA LEKALAAKPS TLALITGMLA AYAVLQAVEG VGLWLLKRWG       180
     EYFAVVATSI FLPLEVHDLA KGITTTRVVT FSINVAAVVY LLISKRLFGV RGGRKAYDVE       240
     RRGEQLLDLE RAAMLT                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page