(data stored in ACNUC1104 zone)

EMBL: CP000717.PE95

CP000717.PE95        Location/Qualifiers
FT   CDS             complement(103843..104796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10095"
FT                   /old_locus_tag="TBFG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0094c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10095"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04438"
FT                   /protein_id="ABR04438.1"
FT                   /translation="MSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDTER
FT                   ARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTPDA
FT                   AAIDRDTRSQAQRNHDGLLAGLRALLASGKLGQHNGLPVSIVVTTTLTDLQTGAGKGFT
FT                   GGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLFAN
FT                   DRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACDPDNRLAEKGWTTHKNTHGH
FT                   TEWLPPPHLDHGQPRTNTFHHPERFLHNQDDDDKPD"
     MSTRQAAEAD LAGKAAQYRP DELARYAQRV MDWLHPDGDL TDTERARKRG ITLSNQQYDG        60
     MSRLSGYLTP QARATFEAVL AKLAAPGATN PDDHTPVIDT TPDAAAIDRD TRSQAQRNHD       120
     GLLAGLRALL ASGKLGQHNG LPVSIVVTTT LTDLQTGAGK GFTGGGTLLP MADVIRMTSH       180
     AHHYSPASGR YPQAIFDHGT PLALYHTKRL ASPAQRIMLF ANDRGCTKPG CDAPAYHSQA       240
     HHVTAWTSTG RTDITELTLA CDPDNRLAEK GWTTHKNTHG HTEWLPPPHL DHGQPRTNTF       300
     HHPERFLHNQ DDDDKPD                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page