(data stored in ACNUC7421 zone)

EMBL: CP000769.PE1

CP000769.PE1         Location/Qualifiers
FT   CDS             48..1430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24221"
FT                   /db_xref="GOA:A7H675"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A7H675"
FT                   /protein_id="ABS24221.1"
FT                   /translation="MDSRASAKWIGPSDETALWARIDTYLRSRLRPDLYDRWFAPLRLV
FT                   SLEGGRLQIAAPDPFHRDFVEDNYRAFFEEFAPGILGRQLPIAFVVDSAPRVASPPAPA
FT                   AGPALSPVPRAAEPADPRESRPNPRYTFDTFVVGESNRFAFAAAQAVAANPGHTWNPLF
FT                   LHGDSGLGKTHLLHALAHAILDKQGGRVAIVSSERYTNDFVAALSKGTMDDFRRKYREC
FT                   TALLVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDARLCSRFEW
FT                   GMRVQVEAPEFETRAAILQKKAEVESIDLPGDVTQLLAAHIRSNVRELEGALMRLAAFA
FT                   SLKSEPITVALARDVLSDVIPPEGYKPTIERIQEAVAAHYGLTVAKLTSSSREQKIALP
FT                   RQAAMYLCRELGKEKFQAIAERFNKKDHTTVIAAVERIRTLMETEEPVRSAVQVLTSKL
FT                   AP"
     MDSRASAKWI GPSDETALWA RIDTYLRSRL RPDLYDRWFA PLRLVSLEGG RLQIAAPDPF        60
     HRDFVEDNYR AFFEEFAPGI LGRQLPIAFV VDSAPRVASP PAPAAGPALS PVPRAAEPAD       120
     PRESRPNPRY TFDTFVVGES NRFAFAAAQA VAANPGHTWN PLFLHGDSGL GKTHLLHALA       180
     HAILDKQGGR VAIVSSERYT NDFVAALSKG TMDDFRRKYR ECTALLVDDV QFLAGKDKTA       240
     EEFFHTFNEL HDHHVQIVLS SDRSPKELKG LDARLCSRFE WGMRVQVEAP EFETRAAILQ       300
     KKAEVESIDL PGDVTQLLAA HIRSNVRELE GALMRLAAFA SLKSEPITVA LARDVLSDVI       360
     PPEGYKPTIE RIQEAVAAHY GLTVAKLTSS SREQKIALPR QAAMYLCREL GKEKFQAIAE       420
     RFNKKDHTTV IAAVERIRTL METEEPVRSA VQVLTSKLAP                             460
//

If you have problems or comments...

PBIL Back to PBIL home page