(data stored in ACNUC7421 zone)

EMBL: CP000769.PE10

CP000769.PE10        Location/Qualifiers
FT   CDS             complement(12461..13609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24230"
FT                   /db_xref="UniProtKB/TrEMBL:A7H684"
FT                   /protein_id="ABS24230.1"
FT                   /translation="MKRLLLLVAAAALASGCVVHSGASRPIYTPPPPPAPAPPPVVSYW
FT                   YHGQHFVPDDLGGGWCYGEGPHQHDYAPHRADWYDLHEGYYYFNGPYVFAYHGGHPVPG
FT                   RGWCYVRGPHTHEYFPPQGTDFAWNRGRGWIYRGGWRPNRPPPPSYWPVVRAPRPSPRP
FT                   AHYDDPRPAPAPARPVYDPRPAPAPYPRPAPTPPRPSPGYERPVPAPAPYPVPSRPGPG
FT                   HSDDAPGHGNLPPGHGGTPPGHASPAPQPPRPPAPVPTTPGRGGEAPGHGGTPPGHAAP
FT                   PPAHGRPDRAVPPSSTPSPGNSGDARGHGGTPPGRAAPPPAQGGRDGAEPRGNGNGKGN
FT                   REGNGRGNGRGRGQREDDDDRREGEQEQGERDGRPARGDGRR"
     MKRLLLLVAA AALASGCVVH SGASRPIYTP PPPPAPAPPP VVSYWYHGQH FVPDDLGGGW        60
     CYGEGPHQHD YAPHRADWYD LHEGYYYFNG PYVFAYHGGH PVPGRGWCYV RGPHTHEYFP       120
     PQGTDFAWNR GRGWIYRGGW RPNRPPPPSY WPVVRAPRPS PRPAHYDDPR PAPAPARPVY       180
     DPRPAPAPYP RPAPTPPRPS PGYERPVPAP APYPVPSRPG PGHSDDAPGH GNLPPGHGGT       240
     PPGHASPAPQ PPRPPAPVPT TPGRGGEAPG HGGTPPGHAA PPPAHGRPDR AVPPSSTPSP       300
     GNSGDARGHG GTPPGRAAPP PAQGGRDGAE PRGNGNGKGN REGNGRGNGR GRGQREDDDD       360
     RREGEQEQGE RDGRPARGDG RR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page