(data stored in ACNUC7421 zone)

EMBL: CP000769.PE105

CP000769.PE105       Location/Qualifiers
FT   CDS             133380..134312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24325"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H9"
FT                   /protein_id="ABS24325.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAPGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHDALKQMLSRARVTGDFLPLERVLERTRTRARAQFAVSRE
FT                   KSYWREASRIVGLVEHEYGDAVADEDWRRLYEGVVDGSLRAFYASPTFEEIRRTPRERW
FT                   LSVDELDSWEFEGTKIWVAIDFAFRDSDGQVRILDWKTGKERGVDHTQVGIYALYAQRK
FT                   WSAPPDQVLGGLVYLVANGAGAGGETVSVAADPAALERCQSEMRHSIGEMKATLQDPAR
FT                   NHALIDQFPQRAQRESCRRCPFRRPCGRM"
     MADLQNEFSW SKSRHEKFAE CRRAYFYAYY GSWGGWEAAP GTPVRELYVL KKLSSRWQWA        60
     GSVVHDALKQ MLSRARVTGD FLPLERVLER TRTRARAQFA VSREKSYWRE ASRIVGLVEH       120
     EYGDAVADED WRRLYEGVVD GSLRAFYASP TFEEIRRTPR ERWLSVDELD SWEFEGTKIW       180
     VAIDFAFRDS DGQVRILDWK TGKERGVDHT QVGIYALYAQ RKWSAPPDQV LGGLVYLVAN       240
     GAGAGGETVS VAADPAALER CQSEMRHSIG EMKATLQDPA RNHALIDQFP QRAQRESCRR       300
     CPFRRPCGRM                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page