(data stored in ACNUC7421 zone)

EMBL: CP000769.PE115

CP000769.PE115       Location/Qualifiers
FT   CDS             complement(144368..145402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0117"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: ade:Adeh_0113 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24335"
FT                   /db_xref="GOA:A7H6I9"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I9"
FT                   /protein_id="ABS24335.1"
FT                   /translation="MLNWLHNMLSRDLAIDLGTANTLIYIRGMGIVSNEPSVVAVQQDA
FT                   RGGRKVLAVGKEAKEMLGRTPGNIVAIRPMKDGVIADFEVTAAMLKYFIQSAHNRKSFV
FT                   KPRIIIGIPSGITEVEKRAVREAAESAGAREVYLIEQPMAAAIGAGLPITEPSGNMIVD
FT                   IGGGTSDVAVISLGGIVYSRSVRIAGDKMDEAIIQHIKRKYNLLIGERTAELIKMGIGT
FT                   AYPTEEELTMDIKGRDLVAGVPRTLTVTSSEIREALSEPINGIVEAVKVTLERTPPELA
FT                   GDIADRGIVLAGGGALLKNLDVLLREETGLPVFLAEDPLSSVVIGAGKALEELDILRQV
FT                   TAHG"
     MLNWLHNMLS RDLAIDLGTA NTLIYIRGMG IVSNEPSVVA VQQDARGGRK VLAVGKEAKE        60
     MLGRTPGNIV AIRPMKDGVI ADFEVTAAML KYFIQSAHNR KSFVKPRIII GIPSGITEVE       120
     KRAVREAAES AGAREVYLIE QPMAAAIGAG LPITEPSGNM IVDIGGGTSD VAVISLGGIV       180
     YSRSVRIAGD KMDEAIIQHI KRKYNLLIGE RTAELIKMGI GTAYPTEEEL TMDIKGRDLV       240
     AGVPRTLTVT SSEIREALSE PINGIVEAVK VTLERTPPEL AGDIADRGIV LAGGGALLKN       300
     LDVLLREETG LPVFLAEDPL SSVVIGAGKA LEELDILRQV TAHG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page