(data stored in ACNUC7421 zone)

EMBL: CP000769.PE116

CP000769.PE116       Location/Qualifiers
FT   CDS             complement(145474..147537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0118"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller; KEGG:
FT                   ade:Adeh_0114 peptidase S9, prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24336"
FT                   /db_xref="GOA:A7H6J0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6J0"
FT                   /protein_id="ABS24336.1"
FT                   /translation="MLTSALAALAVAAAAAAPRPFTVDDLVALPRVGAPELSPDGTLLA
FT                   FTVGRLTGAGDRIVSTLYVAPAAGGASRQLTDRDERISSPRFSPDGKRLAFVSTRSGAP
FT                   QAHVLDLASGQIRVASALPGGANELSWTPDGAALLVTADVDPRCGADAGCNAKAEAEAK
FT                   GKPRVATRLLFRHWNAWRERLRTHVLKVPLDGGAPSDLTPGDRDAPPAVRGGPGDLAVS
FT                   PDGKTLYFTAVDDALEAASTNADVFAVPLAGGEARRVTSGPGWDASPRPSPDGKRLAWL
FT                   SQARGGYESDRVRVMVAGIDGKDARDLTAGVDLSASDLHWARKGGALRFVALTSGYHEV
FT                   YEVDVRSGELVKLAGAPALAGRPRVNVQSVSYSADGARVAALVDGTTAPPEIAVLEGKP
FT                   GKARWAERTRLAADALAGIARPTLRPLEATSKDGTKVFGWIVLPAEHRDGQRHPAAVLV
FT                   HGGPQGAWNDAWTSRWNAMLYAARGYAVVLPNPRGSTGYGQAYVDAVSRDWGGKPYEDV
FT                   MALVDAAIALGAVDGARMCAAGASYGGYMVHWLNGQTERFRCLVSHAGIFDLEAFFYRT
FT                   EELWFPEWEFGGTPFDQPADYQKFSPHRFVQRWRTPTLVSVGELDYRTTVDHGYAAFTA
FT                   LQRRGIPSKLLVFPDEGHWVSKPKNARVFYDVVLGWLDEHLAPAANVSAKAR"
     MLTSALAALA VAAAAAAPRP FTVDDLVALP RVGAPELSPD GTLLAFTVGR LTGAGDRIVS        60
     TLYVAPAAGG ASRQLTDRDE RISSPRFSPD GKRLAFVSTR SGAPQAHVLD LASGQIRVAS       120
     ALPGGANELS WTPDGAALLV TADVDPRCGA DAGCNAKAEA EAKGKPRVAT RLLFRHWNAW       180
     RERLRTHVLK VPLDGGAPSD LTPGDRDAPP AVRGGPGDLA VSPDGKTLYF TAVDDALEAA       240
     STNADVFAVP LAGGEARRVT SGPGWDASPR PSPDGKRLAW LSQARGGYES DRVRVMVAGI       300
     DGKDARDLTA GVDLSASDLH WARKGGALRF VALTSGYHEV YEVDVRSGEL VKLAGAPALA       360
     GRPRVNVQSV SYSADGARVA ALVDGTTAPP EIAVLEGKPG KARWAERTRL AADALAGIAR       420
     PTLRPLEATS KDGTKVFGWI VLPAEHRDGQ RHPAAVLVHG GPQGAWNDAW TSRWNAMLYA       480
     ARGYAVVLPN PRGSTGYGQA YVDAVSRDWG GKPYEDVMAL VDAAIALGAV DGARMCAAGA       540
     SYGGYMVHWL NGQTERFRCL VSHAGIFDLE AFFYRTEELW FPEWEFGGTP FDQPADYQKF       600
     SPHRFVQRWR TPTLVSVGEL DYRTTVDHGY AAFTALQRRG IPSKLLVFPD EGHWVSKPKN       660
     ARVFYDVVLG WLDEHLAPAA NVSAKAR                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page